PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01344.1.p
Common NameEUGRSUZ_J01344
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 79aa    MW: 8579.6 Da    PI: 8.7991
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01344.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer90.81.2e-282276358
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                      ++rY eC++NhAas+Ggh vDGC Ef p  g eg+  a++Ca CgCHRnFHR+ ve
  Eucgr.J01344.1.p 22 RIRYAECQRNHAASTGGHQVDGCTEFRPR-GVEGSDLAFTCATCGCHRNFHRKVVE 76
                      78**************************8.9999*******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-152076IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-262375IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-222473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.4472574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MKKVVLGRGE ESSNASSSRM PRIRYAECQR NHAASTGGHQ VDGCTEFRPR GVEGSDLAFT  60
CATCGCHRNF HRKVVENP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01344.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559051.14e-23PREDICTED: mini zinc finger protein 2
SwissprotQ9CA512e-21MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A059ADI18e-53A0A059ADI1_EUCGR; Uncharacterized protein
STRINGSolyc02g067330.1.14e-22(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-22mini zinc finger 1